Strigops habroptila (Kakapo): 115605339 Help Entry 115605339         CDS       T08851                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism shab  Strigops habroptila (Kakapo) Pathway shab04060   Cytokine-cytokine receptor interaction shab04218   Cellular senescence shab04620   Toll-like receptor signaling pathway shab04621   NOD-like receptor signaling pathway shab04622   RIG-I-like receptor signaling pathway shab05132   Salmonella infection shab05164   Influenza A Brite KEGG Orthology (KO) [BR:shab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115605339  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     115605339  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115605339    04621 NOD-like receptor signaling pathway     115605339    04622 RIG-I-like receptor signaling pathway     115605339  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     115605339   09171 Infectious disease: bacterial    05132 Salmonella infection     115605339  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shab04052]     115605339    00536 Glycosaminoglycan binding proteins [BR:shab00536]     115605339 Cytokines and neuropeptides [BR:shab04052]  Cytokines   Chemokines    115605339 Glycosaminoglycan binding proteins [BR:shab00536]  Heparan sulfate / Heparin   Chemokines    115605339 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 SEN2-like_N Motif Other DBs NCBI-GeneID:  115605339 NCBI-ProteinID:  XP_030335465 LinkDB All DBs Position 3:complement(86588443..86591160) Genome browser AA seq 120 aa AA seqDB search MGGRSAAAALVLCLVFMVRSEGKALAKTAGKSFQCLCDSTHSKFIPPQAIQSVRLNQRGP RCQNVEIIATLRSGRLVCLEPSASWVRLTVKAILARARSNTESPLKEKSRKMTSRSFSRI NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgggtggcagatctgctgctgctgctttggttctctgcttggtcttcatggtgaggtca gaaggtaaggccctggcgaagacagcggggaaaagcttccagtgcttgtgtgacagcact cattccaagttcatccccccccaggctatccagagtgtgagattaaaccaaagaggacct cgctgccaaaacgtggaaatcatagctacactgagatccggcaggctggtgtgcctggaa ccctctgcttcctgggtccggctcactgtgaaggctattttggccagggccagaagcaat actgaatcacctctcaaagaaaagtcaaggaaaatgacatctcggagtttttctaggata tga

DBGET integrated database retrieval system