Strigops habroptila (Kakapo): 115607639 Help Entry 115607639         CDS       T08851                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism shab  Strigops habroptila (Kakapo) Pathway shab04010   MAPK signaling pathway shab04012   ErbB signaling pathway shab04068   FoxO signaling pathway shab04137   Mitophagy - animal shab04140   Autophagy - animal shab04144   Endocytosis shab04150   mTOR signaling pathway shab04210   Apoptosis shab04218   Cellular senescence shab04370   VEGF signaling pathway shab04371   Apelin signaling pathway shab04510   Focal adhesion shab04540   Gap junction shab04625   C-type lectin receptor signaling pathway shab04810   Regulation of actin cytoskeleton shab04910   Insulin signaling pathway shab04912   GnRH signaling pathway shab04916   Melanogenesis shab05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115607639 (HRAS)    04012 ErbB signaling pathway     115607639 (HRAS)    04370 VEGF signaling pathway     115607639 (HRAS)    04371 Apelin signaling pathway     115607639 (HRAS)    04068 FoxO signaling pathway     115607639 (HRAS)    04150 mTOR signaling pathway     115607639 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115607639 (HRAS)    04140 Autophagy - animal     115607639 (HRAS)    04137 Mitophagy - animal     115607639 (HRAS)   09143 Cell growth and death    04210 Apoptosis     115607639 (HRAS)    04218 Cellular senescence     115607639 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     115607639 (HRAS)    04540 Gap junction     115607639 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     115607639 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115607639 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     115607639 (HRAS)    04912 GnRH signaling pathway     115607639 (HRAS)    04916 Melanogenesis     115607639 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115607639 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shab04131]     115607639 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shab04147]     115607639 (HRAS)    04031 GTP-binding proteins [BR:shab04031]     115607639 (HRAS) Membrane trafficking [BR:shab04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     115607639 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     115607639 (HRAS) Exosome [BR:shab04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115607639 (HRAS)   Exosomal proteins of colorectal cancer cells    115607639 (HRAS) GTP-binding proteins [BR:shab04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115607639 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  115607639 NCBI-ProteinID:  XP_030341032 UniProt:  A0A672TJ54 LinkDB All DBs Position 4:complement(48582054..48625056) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggagctggtggtgttgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcattgatggagagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgaggacaggggaaggattcctctgc gtgtttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgacctc ccagcacggacagtggaaacccggcaagcgcaggacctggcccggagttacggaatcccc tacatagaaacatctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system