Strigops habroptila (Kakapo): 115608770 Help Entry 115608770         CDS       T08851                                  Symbol ELOB Name (RefSeq) LOW QUALITY PROTEIN: elongin-B   KO K03873   elongin-B Organism shab  Strigops habroptila (Kakapo) Pathway shab04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:shab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115608770 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:shab04121]     115608770 (ELOB)    03400 DNA repair and recombination proteins [BR:shab03400]     115608770 (ELOB) Ubiquitin system [BR:shab04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115608770 (ELOB)    Cul5 complex      115608770 (ELOB) DNA repair and recombination proteins [BR:shab03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115608770 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin DUF3109 Motif Other DBs NCBI-GeneID:  115608770 NCBI-ProteinID:  XP_030343951 LinkDB All DBs Position 5:complement(62403457..62403819) Genome browser AA seq 120 aa AA seqDB search MDVCLMICCHKTTIFTKAEEATAHELKKVVEGTTKRLPKEQWLYKDDQLLDDDHRTLLDC SLSSXSCHPHVPAMVGLALFRPGNDTFEQLHIDPSSNTLKLPVVMQLQESGSSSSKEALC NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtctgcttgatgatttgctgtcacaagacaacaatcttcactaaggctgaagag gcaactgcgcatgagttgaaaaaggtggtggagggaacaacgaagaggctgccaaaggaa cagtggctctacaaagatgaccaactgctggatgatgatcataggactttgctagactgt agcttaagcagctaaagctgtcatcctcatgttcctgccatggtgggcttggctttattc agacctggcaatgacacctttgaacaactgcatattgatccctcctcaaacaccttgaag ctacctgttgttatgcagttacaggagtctggtagcagctctagcaaggaagccttgtgt taa

DBGET integrated database retrieval system