Strigops habroptila (Kakapo): 115609837 Help Entry 115609837         CDS       T08851                                  Symbol CD24 Name (RefSeq) signal transducer CD24   KO K06469   CD24 antigen Organism shab  Strigops habroptila (Kakapo) Pathway shab04148   Efferocytosis Brite KEGG Orthology (KO) [BR:shab00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     115609837 (CD24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:shab04090]     115609837 (CD24)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shab00537]     115609837 (CD24) CD molecules [BR:shab04090]  Proteins   115609837 (CD24) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shab00537]  Antigens   115609837 (CD24) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD24 Motif Other DBs NCBI-GeneID:  115609837 NCBI-ProteinID:  XP_030346411 LinkDB All DBs Position 6:16359351..16364330 Genome browser AA seq 87 aa AA seqDB search MGTALAARLGLGLLLLALLLPTQIYCDANGTNGTSPTPSNNSSASSTYLSAVTNSLNNTT TQGHGNCLHSTTSLLVILSVSLLYFCC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggggacggcgctggcggcgcggctcggcttggggctcctgctcctggccctcctcctc cccacgcagatttactgcgatgccaatggaacaaatggaacaagtccaacaccttcaaac aattcttcagcaagttccacttacctgtcagctgtcacaaattcactgaacaataccacc actcagggacatggaaattgccttcactcaaccacaagtcttcttgtcattctctcagtt tctcttctgtatttttgctgttaa

DBGET integrated database retrieval system