KEGG   Strigops habroptila (Kakapo): 115611595
Entry
115611595         CDS       T08851                                 
Symbol
NCBP2
Name
(RefSeq) nuclear cap-binding protein subunit 2 isoform X1
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
shab  Strigops habroptila (Kakapo)
Pathway
shab03013  Nucleocytoplasmic transport
shab03015  mRNA surveillance pathway
shab03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:shab00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    115611595 (NCBP2)
  09122 Translation
   03013 Nucleocytoplasmic transport
    115611595 (NCBP2)
   03015 mRNA surveillance pathway
    115611595 (NCBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:shab03019]
    115611595 (NCBP2)
   03041 Spliceosome [BR:shab03041]
    115611595 (NCBP2)
Messenger RNA biogenesis [BR:shab03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     115611595 (NCBP2)
Spliceosome [BR:shab03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    115611595 (NCBP2)
SSDB
Motif
Pfam: RRM_1 RRM_occluded
Other DBs
NCBI-GeneID: 115611595
NCBI-ProteinID: XP_030350611
UniProt: A0A672UTT2
LinkDB
Position
8:complement(23118280..23136025)
AA seq 157 aa
MCSAGTLSVLRSDSYVDLSQYRDQHFRGTRRDQERLLRKSCTLYVGNLSFYTTEEQIHEL
FGKSGDIKKVIMGLDKVKKTACGFCFVEYYARGDAENAMRYINGTRLDDRIIRTDWDAGF
KEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKAVQCQ
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtgctccgcggggacgctgagcgtcttgcgcagcgactcttacgttgacctcagccag
taccgggaccagcacttccgggggacgcggcgcgaccaggagcggctgctgaggaagagc
tgcacgctgtacgtggggaacctctccttctacaccacggaggagcagatccacgagctc
ttcggtaagagcggcgacatcaagaaggtcatcatggggctggacaaagtgaagaagacc
gcctgcggcttctgcttcgtggagtattatgcaagaggagatgctgaaaatgccatgcga
tacatcaacggaaccagacttgatgataggatcataaggacagactgggatgcaggattt
aaggagggtagacagtatggtcgtggaagatcagggggccaggttcgagatgaatatcgg
caagactatgatgctggaagaggtggctatggcaaagctgttcagtgccagtga

DBGET integrated database retrieval system