Strigops habroptila (Kakapo): 115613500 Help Entry 115613500         CDS       T08851                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism shab  Strigops habroptila (Kakapo) Pathway shab04814   Motor proteins shab05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shab00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     115613500 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115613500 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:shab03037]     115613500 (DYNLT1)    04812 Cytoskeleton proteins [BR:shab04812]     115613500 (DYNLT1) Cilium and associated proteins [BR:shab03037]  Motile cilia and associated proteins   Dynein arm    115613500 (DYNLT1) Cytoskeleton proteins [BR:shab04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      115613500 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  115613500 NCBI-ProteinID:  XP_030354838 UniProt:  A0A672UDK7 LinkDB All DBs Position 10:1210636..1216757 Genome browser AA seq 113 aa AA seqDB search MDEFQPGEETSFVVDEVSAIIKEAIEGAIGGNTYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTVYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagttccagccgggggaggagacttcctttgttgttgatgaagtcagtgccatc attaaagaggccattgaaggtgcgataggtggcaatacctaccagcacagcaaggtgaac cagtggacaaccagtgtggtggagcaaacgctgagccaactcacaaagctggggaagcct ttcaagtatattgtgacctgtgtgattatgcaaaagaatggtgctgggctacacacagca agctcttgcttctgggacaactccagtgatgggacctgcactgtgagatgggagaataag acggtgtactgtattgtcagtgcctttggactcgccatctga

DBGET integrated database retrieval system