Strigops habroptila (Kakapo): 115619511 Help Entry 115619511         CDS       T08851                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K05408   C-C motif chemokine 3 Organism shab  Strigops habroptila (Kakapo) Pathway shab04060   Cytokine-cytokine receptor interaction shab04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:shab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115619511 (CCL22)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115619511 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shab04052]     115619511 (CCL22)    00536 Glycosaminoglycan binding proteins [BR:shab00536]     115619511 (CCL22) Cytokines and neuropeptides [BR:shab04052]  Cytokines   Chemokines    115619511 (CCL22) Glycosaminoglycan binding proteins [BR:shab00536]  Heparan sulfate / Heparin   Chemokines    115619511 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 UL128 CXCL16 Motif Other DBs NCBI-GeneID:  115619511 NCBI-ProteinID:  XP_030367744 LinkDB All DBs Position Z:22420446..22421863 Genome browser AA seq 109 aa AA seqDB search MFAARTVLLLTLLLTFSLHHITAHIRPTECCTSYAQRTVRHVKSFYKTPQGCSLPAVVIL AATGDEVCADPKKPWVKRAIQNLQNKKLNPPSTVHHLTRPSSPPVSGGS NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgttcgctgcaaggacagtcctgctgctcacccttctcctcaccttctccctgcaccac atcacagcccacattaggcccactgaatgctgcaccagttatgcgcagagaactgtccga cacgtgaagagcttctacaagacgccccaaggctgctccctgcctgcagtcgtgatattg gctgccactggtgatgaggtctgcgccgaccccaagaagccctgggtgaagagagccata caaaaccttcagaataaaaaattaaatcctccttccactgtccaccatctaactcgccca tccagtcctcctgtctctggagggagctga

DBGET integrated database retrieval system