KEGG   Sediminicurvatus halobius: LMH63_04660
Entry
LMH63_04660       CDS       T09389                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
shai  Sediminicurvatus halobius
Pathway
shai02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:shai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LMH63_04660 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shai02000]
    LMH63_04660 (phnC)
Enzymes [BR:shai01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     LMH63_04660 (phnC)
Transporters [BR:shai02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    LMH63_04660 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_16 AAA_23 AAA_30 AAA_22 RsgA_GTPase AAA_33 SbcC_Walker_B Zeta_toxin AAA_19 nSTAND1 AAA_25 AAA_24 MMR_HSR1 PRK Rad17 DO-GTPase2
Other DBs
NCBI-ProteinID: UEX78938
LinkDB
Position
1007648..1008454
AA seq 268 aa
MLEINDLVKTYPDGQQALRGCSLTVPAAEVVAIIGPSGAGKSTFIRCINRLVTPTGGSIR
LDGEELTTHRERRLRETRRQIGMIFQEFNLIERLTVMENVLAGRLGSVGFLQAFLRRFPA
QDVERAFELLERVGLGGYENSRADALSGGQRQRVGIARALMQEPRLLLVDEPTSSLDPKV
ARSIMALICELAGERRIPALINIHDVGLALGFAQRVVGLNAGSVVFDGPPSAVDEAVLTR
IYGADDWRDAFRQEGEEDRHLGSREAVS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgcttgagatcaatgacctggtcaagacctacccggatggccagcaggcgctgcgcggc
tgcagcctcacggtgccggccgccgaagtggtggcgatcatcggcccctcgggcgccggc
aagagcacgttcattcgctgcatcaaccgtctggtcaccccgaccggcggcagcatccgc
ctcgatggcgaggagctcaccacgcaccgcgagcgccgcctgcgcgagacacggcgccag
atcggcatgattttccaggagttcaacctcatcgagcgcctgacggtcatggagaacgtc
ctcgccgggcggcttggctccgtggggttcctgcaggcgttcctgcgccggttcccggcg
caggatgtggagcgtgccttcgagctgctggagcgggtcggcctcggcggctacgagaac
agccgggcggacgcgctctccggcggccagcgccagcgcgtgggcattgcccgcgcgctt
atgcaggagccccgcctgctgctggtggacgagcccacgtcgtcgctggacccgaaggtg
gcacgctcgatcatggcgctgatctgcgagcttgccggcgagcggcggatcccggcgctc
atcaacattcacgacgtcgggctcgccctgggtttcgcgcagcgcgtcgtcgggctgaat
gcgggcagcgtggtcttcgacggaccgccgtccgcggtggacgaggccgtgctcacccgc
atctatggtgccgacgactggcgtgacgccttccgccaggagggcgaggaggatcgtcac
ctgggctcgcgggaggcggtctcgtga

DBGET integrated database retrieval system