Sediminicurvatus halobius: LMH63_12060 Help Entry LMH63_12060       CDS       T09389                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shai  Sediminicurvatus halobius Pathway shai00998   Biosynthesis of various antibiotics shai01100   Metabolic pathways shai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LMH63_12060 (acpP)    00074 Mycolic acid biosynthesis     LMH63_12060 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LMH63_12060 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UEX76688 LinkDB All DBs Position complement(2650756..2650995) Genome browser AA seq 79 aa AA seqDB search MSSIEDRVKKIVVEQLGVKEEEVTSEASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYINRHLEQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagtatcgaggaccgcgttaagaagatcgtcgtcgagcagctgggggtgaaagag gaagaggtcacgtccgaggcctcgttcgtggacgatcttggcgccgactcgctggatacc gtggagctcgtgatggccctcgaggaggagttcgagtgcgagatccctgacgaggaggcc gagaagatcacgacggtccagcaggcgatcgactatatcaaccggcatctcgagcagtaa

DBGET integrated database retrieval system