Sediminicurvatus halobius: LMH63_12515
Help
Entry
LMH63_12515 CDS
T09389
Name
(GenBank) ankyrin repeat domain-containing protein
Organism
shai
Sediminicurvatus halobius
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ank_2
Ank
Ank_4
Ank_3
Ank_5
Ank_KRIT1
DUF4440
Motif
Other DBs
NCBI-ProteinID:
UEX76777
LinkDB
All DBs
Position
2742523..2743308
Genome browser
AA seq
261 aa
AA seq
DB search
MRRRFACLLTLALTTGLTGHAIAATAEREWREAITQRDPVALARLLHQRADPDPAGAGGV
TALMVAAASGETGLVVDLLAAGADVHARNDKGASALLYAAHRGHAEVVRRLLDAGADVDV
AASNGWTALTLAAATGRTETVQVLLAVGADPNHPDVYRWTPLMRAVDNGHRAVARQLLAD
DRTRVDLRDDAGMTALHHAARRGGQATARALAARCADPAAESIGGHTPLDILRERWGDTG
EWLQRAAREANCRAGVAQAAD
NT seq
786 nt
NT seq
+upstream
nt +downstream
nt
atgcgccgacgcttcgcctgtctgctgacgctcgccctgaccactggcctgaccggccat
gccatcgcggccaccgccgaacgcgagtggcgcgaggccatcacccagcgcgatccggtc
gccctcgcccggctgctccaccagcgcgccgaccccgatccggccggcgccggtggcgtc
accgccctcatggtcgccgccgcgagcggcgagaccgggctggtggtcgatctgctggcg
gccggagccgacgtgcacgcccgcaacgacaagggcgccagcgccctcctctacgccgcc
catcgcggccatgcggaggttgtgcgccggctcctcgatgccggggcggatgtggacgtc
gccgcgagcaacggctggaccgccctcaccctcgccgcggccacgggccggacggagacg
gtgcaggtcctgctcgccgttggcgccgatccgaaccatcccgacgtctatcgctggaca
ccgctgatgcgggcggtggacaacggccaccgcgccgtggcccgtcagctgctggcggac
gaccgcacccgggtagaccttcgggacgacgccggcatgacggccctgcatcacgccgcc
cgccggggcggccaggcgacggcgcgggcactggcggcgcgatgtgccgatccggcggcg
gaatccattggcggccatacgccgttggacatcctgcgcgagcgctggggcgacaccggg
gaatggctgcagcgcgccgcccgcgaggcgaactgccgcgcgggcgtggcccaggccgcg
gactga
DBGET
integrated database retrieval system