Sulfurospirillum halorespirans: SHALO_0942 Help Entry SHALO_0942        CDS       T04475                                  Name (GenBank) cytochrome c oxidase subunit IV   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism shal  Sulfurospirillum halorespirans Pathway shal00190   Oxidative phosphorylation shal01100   Metabolic pathways Module shal_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:shal00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SHALO_0942 Enzymes [BR:shal01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      SHALO_0942 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro Motif Other DBs NCBI-ProteinID:  AOO64723 UniProt:  A0A1D7TIC0 LinkDB All DBs Position complement(961805..962077) Genome browser AA seq 90 aa AA seqDB search MTYTLALYTKVLAGLLLLTLLTFIQPTLYHLTPGNTAGVQLGISIIKIGLVSAFYMHLRS ENAYLKGYIVMALIIMLIFFVIVGIDVAHS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacatacactcttgctctttatacaaaagtattggcaggtctgttgttactgaccctg ctcacgttcatacagcccacattgtatcatctgacaccgggaaatacagcgggtgtacag ttagggataagtattataaagatagggcttgtcagtgcattttacatgcatttgcgtagt gaaaacgcctatttaaaaggctatatcgtgatggctttgatcatcatgcttatttttttt gtgatcgtcggtatcgacgtggcacattcgtaa

DBGET integrated database retrieval system