KEGG   Sulfurospirillum halorespirans: SHALO_1733
Entry
SHALO_1733        CDS       T04475                                 
Name
(GenBank) aspartokinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
shal  Sulfurospirillum halorespirans
Pathway
shal00260  Glycine, serine and threonine metabolism
shal00261  Monobactam biosynthesis
shal00270  Cysteine and methionine metabolism
shal00300  Lysine biosynthesis
shal01100  Metabolic pathways
shal01110  Biosynthesis of secondary metabolites
shal01120  Microbial metabolism in diverse environments
shal01210  2-Oxocarboxylic acid metabolism
shal01230  Biosynthesis of amino acids
Module
shal_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
shal_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SHALO_1733
   00270 Cysteine and methionine metabolism
    SHALO_1733
   00300 Lysine biosynthesis
    SHALO_1733
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SHALO_1733
Enzymes [BR:shal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     SHALO_1733
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT_7 ACT DraK_HK_N ACT_6 ACT_4
Other DBs
NCBI-ProteinID: AOO65504
UniProt: A0A1D7TKQ8
LinkDB
Position
complement(1733259..1734461)
AA seq 400 aa
MLIVQKYGGTSVGNVERIEAVAKRVIESKQEGHDLVVVVSAMSGETNKLLEYAAHFSTTP
NHREVDMLLSSGERVTSALLAIALEAEGYAAVSMSGRRAGIVTDAVHTKARIEYIDTTLM
KKELKEGKIVVVAGFQGVTENGEVSTLGRGGSDLSAVAIAGALEADLCEIYTDVDGVYTT
DPRIEPKAKKLDKISYDEMLELASLGAKVLQSRSVEMAKKLNVNLVTRSSFNKHEGTLIT
KEDKIMEQPLVSGIALDKNQARVTLRGVTDKPGIAAEIFKKLADCNVNVDMIIQNVGHDG
TTNLGFTVPQNELEMTKAAMSELRASDVMEYDSDIVKVSVVGVGMKSHSGVACKAFDTMA
KEGINIEMISTSEIKISMVIQAKYGELAVRALHSAYQLDK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgttgatcgttcaaaaatacggaggaacgagtgttggcaatgttgagcgcattgaggct
gttgccaaacgagtcatagaaagcaaacaagagggacacgatcttgtcgtcgttgtttcc
gcgatgagtggtgagaccaataaacttttagagtatgcagcgcattttagcacaacaccc
aatcatcgcgaagtcgatatgttattaagttctggtgagcgtgtgaccagtgctttgctt
gcgattgcgcttgaagcagagggttatgctgctgtttcgatgagcggacgtcgtgctggg
attgtgaccgatgcggttcataccaaagcgcgtattgaatacatcgatacgacactgatg
aaaaaagagctaaaagaaggcaaaattgtcgtcgttgcaggctttcaaggtgtgaccgaa
aacggtgaagtctcaacgctgggtcgtggaggcagtgatctttctgcggttgcgattgca
ggagcgttagaagcggatctgtgtgagatttacaccgatgtggatggtgtttatacaacc
gatcctcgcattgaacctaaggctaaaaaactcgataaaatcagctacgatgagatgtta
gagctcgcaagtttgggggcgaaagtgcttcaaagccgctctgttgagatggcaaaaaaa
ctcaacgtcaatctcgtgacacgcagtagctttaacaaacacgaaggaacacttattaca
aaggaagataagattatggaacaaccattagttagcggtattgcactcgataaaaaccaa
gccagagtgacacttcgcggtgttacggataagcctggcattgcggctgagatttttaaa
aaactcgctgattgtaacgttaacgttgatatgattatccaaaatgtaggacacgatggc
acaacaaaccttggttttactgttcctcaaaatgagctagagatgacaaaagctgctatg
agtgagcttagagcaagtgatgttatggagtatgacagtgacatcgttaaagtctcagtt
gtgggtgtaggtatgaaatcgcacagtggtgtggcgtgtaaagcgtttgacacgatggca
aaagagggcattaacatcgagatgatcagtaccagcgagatcaaaatctctatggttatt
caagcaaaatacggtgaacttgccgttcgtgcccttcacagtgcttaccaattggataaa
taa

DBGET integrated database retrieval system