KEGG   Sphingomonas hankookensis: PPZ50_02315
Entry
PPZ50_02315       CDS       T08811                                 
Name
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
shan  Sphingomonas hankookensis
Pathway
shan00220  Arginine biosynthesis
shan00250  Alanine, aspartate and glutamate metabolism
shan00270  Cysteine and methionine metabolism
shan00330  Arginine and proline metabolism
shan00350  Tyrosine metabolism
shan00360  Phenylalanine metabolism
shan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shan00401  Novobiocin biosynthesis
shan01100  Metabolic pathways
shan01110  Biosynthesis of secondary metabolites
shan01210  2-Oxocarboxylic acid metabolism
shan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PPZ50_02315
   00270 Cysteine and methionine metabolism
    PPZ50_02315
   00220 Arginine biosynthesis
    PPZ50_02315
   00330 Arginine and proline metabolism
    PPZ50_02315
   00350 Tyrosine metabolism
    PPZ50_02315
   00360 Phenylalanine metabolism
    PPZ50_02315
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPZ50_02315
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    PPZ50_02315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shan01007]
    PPZ50_02315
Enzymes [BR:shan01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     PPZ50_02315
Amino acid related enzymes [BR:shan01007]
 Aminotransferase (transaminase)
  Class I
   PPZ50_02315
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Asp_aminotransf Cys_Met_Meta_PP Aminotran_5 CBP_BcsO
Other DBs
NCBI-ProteinID: WCP72415
LinkDB
Position
466984..468183
AA seq 399 aa
MKPSAALDRINPSPTLAITSKVLELKRQGVDVIGLGAGEPDFDTPDFVKDAAIEAIRAGK
TKYTNVDGTVELKDAIIAKFKRDNGLTYAANQISVNVGGKHTLFNALVATVDAGDEVIVP
APYWVSYPDVVQFAGGTPVFIAAGADQNYKITPEQLDAAITEKTKWVILNSPSNPTGAGY
TRDELRELGKVLERHPHVWIFADDMYEHIVYPGFEFATIAEVNPALYDRTLTVNGCSKAY
AMTGWRIGYAAGAAWLIKAMAKLQSQSTSNPCSIAQAAAVAALNGDQSFLAERNAAFQRR
RDLVVAELNAIPGITCPTPEGAFYVYPDISGLIGKTTPAGKRIDTDEDFVGYLLEDARVA
AVQGAAFGLSPAMRISYATSDELLAEACARIRSACAALK
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaagccctccgccgcgctcgaccgcatcaacccgtcgccgaccctcgccatcacgtcg
aaggtgctcgaactgaagcggcagggcgtcgacgtcattggcctgggcgcgggcgaaccc
gatttcgacacgcccgatttcgtgaaggacgccgcgatcgaggcgatccgcgccggcaag
accaaatataccaatgtcgacggcaccgtcgagctgaaggacgcgatcatcgcgaagttc
aagcgcgacaacggcctgacctatgccgcgaaccagatcagcgtgaatgtcggcggcaag
cacacgctgttcaacgcgctggtcgcgacggtcgatgcgggggacgaggtgatcgtgccc
gcgccctattgggtcagctaccccgacgtcgtgcagttcgcgggcgggacgccggtgttc
atcgcggccggcgccgaccagaattacaagatcacccccgaacagctcgatgccgcgatc
accgagaagacgaagtgggtcatcctcaattcgccatccaacccgaccggcgcgggctat
acccgcgacgagctgcgcgaactgggcaaggtgctggagcggcatccgcatgtgtggatc
ttcgccgacgatatgtacgagcatatcgtctatcccggcttcgaattcgcgacgatcgcc
gaggtcaacccggcgctgtacgaccgcacgctgacggtgaacggctgttcgaaggcctat
gccatgaccggctggcgcatcggctatgctgcgggcgcggcatggctgatcaaggcgatg
gccaagctgcagtcgcaatcgaccagcaatccctgttcgatcgcgcaggccgccgccgtc
gccgcgctgaatggcgaccagtcgttcctggccgaacgcaacgccgcgttccagcggcgg
cgcgacctggtcgtcgccgagctgaatgcgattcccggcatcacctgcccgacgcccgaa
ggcgccttctatgtctatcccgacatctccgggctgatcggcaagacgactccggcgggc
aagcggatcgacaccgacgaggatttcgtcggctatctgctggaggacgccagggtcgcg
gcggtgcagggcgcggcgttcggcctgtcgcccgcgatgcggatcagctatgccacgtcg
gacgaactgctggccgaagcgtgcgcccgcatccggtcggcgtgcgccgcgctcaagtaa

DBGET integrated database retrieval system