Sphingomonas hankookensis: PPZ50_12320 Help Entry PPZ50_12320       CDS       T08811                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shan  Sphingomonas hankookensis Pathway shan01100   Metabolic pathways shan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PPZ50_12320    00074 Mycolic acid biosynthesis     PPZ50_12320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PPZ50_12320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  WCP71140 LinkDB All DBs Position complement(2623276..2623512) Genome browser AA seq 78 aa AA seqDB search MSETAERVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgaacgcgttaagaagatcgtcgtcgagcatctcggcgtcgaagcg gaaaaggttaccgaagacgcgagcttcatcgacgatctgggcgcggacagcctcgacatc gtcgagctggtaatggcgttcgaggaagaattcggcgtcgagatccccgacgatgccgcc gagaagatcacgaccgtcaaggacgcgatcacctatatcgacgagcacaagggctga

DBGET integrated database retrieval system