Shewanella halotolerans: K0H81_02955 Help Entry K0H81_02955       CDS       T09172                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism shao  Shewanella halotolerans Pathway shao02024   Quorum sensing shao03018   RNA degradation Brite KEGG Orthology (KO) [BR:shao00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     K0H81_02955 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     K0H81_02955 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:shao03019]     K0H81_02955 (hfq)    03036 Chromosome and associated proteins [BR:shao03036]     K0H81_02955 (hfq) Messenger RNA biogenesis [BR:shao03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      K0H81_02955 (hfq) Chromosome and associated proteins [BR:shao03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     K0H81_02955 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QYJ90572 LinkDB All DBs Position 650060..650338 Genome browser AA seq 92 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPARPFNVSSHHNTPNQAAGYNAPHDDSAE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcaaaggggcaatctttacaagacccatttttgaacgcattacgacgtgaacgcgtt ccggtatctatctacctagttaacggtatcaagcttcagggacaagttgagtcattcgat cagtttgttattttattgaagaacactgtcagccagatggtttataagcacgctatctct accgtggtgcctgcgcgtccatttaacgtgagcagccatcacaacacgcctaaccaggcg gcgggttacaatgcaccacatgacgatagcgctgagtaa

DBGET integrated database retrieval system