Shewanella halotolerans: K0H81_11830 Help Entry K0H81_11830       CDS       T09172                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shao  Shewanella halotolerans Pathway shao01100   Metabolic pathways shao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0H81_11830 (acpP)    00074 Mycolic acid biosynthesis     K0H81_11830 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0H81_11830 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB Motif Other DBs NCBI-ProteinID:  QYJ88507 LinkDB All DBs Position complement(2764834..2765067) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKPAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcattatcgagcaactgggcgttaaagaa gaagacgtaaaaccagcagcatctttcgttgacgacctaggtgcagattctctggacacc gttgagttggtaatggctctagaagaagagtttgacactgagatccctgatgaagaagct gaaaagatcactactgttcaagcagcgatcgattacgtttctaagaatcagtaa

DBGET integrated database retrieval system