Shewanella halotolerans: K0H81_18360 Help Entry K0H81_18360       CDS       T09172                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shao  Shewanella halotolerans Pathway shao01100   Metabolic pathways shao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0H81_18360    00074 Mycolic acid biosynthesis     K0H81_18360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0H81_18360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  QYJ89698 LinkDB All DBs Position 4248188..4248436 Genome browser AA seq 82 aa AA seqDB search MQNREQILQMLTQILVDEFEIDADDITPEASLYQELDLDSIDAVDLVIKLQQLTGKKIQP DEFKAVRTVDDVVTAIEGLVKQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgagcaaattctacagatgctgactcagatcctagttgatgagtttgaa atcgatgccgacgacatcaccccagaggcgtctctgtaccaagagctggatctggacagc atagacgctgtggatctggtgattaaactacaacaactcacgggcaagaagatccagccc gacgagtttaaggccgtgcgtaccgtcgatgacgtagttacggctatcgaagggctagtg aagcagtaa

DBGET integrated database retrieval system