Streptomyces harbinensis: HUT13_07590 Help Entry HUT13_07590       CDS       T07389                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shar  Streptomyces harbinensis Pathway shar00998   Biosynthesis of various antibiotics shar01100   Metabolic pathways shar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUT13_07590    00074 Mycolic acid biosynthesis     HUT13_07590   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUT13_07590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QKV68661 LinkDB All DBs Position complement(1738342..1738620) Genome browser AA seq 92 aa AA seqDB search MAYSTDADEIFPTLQQIVSETLRVPIEQVTRESALSDLGMVESIKLLRVAGKIERRFDIE LDDSLFFQGVSMGRLVDEIAAQRAAAVSGEAA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcgtactccaccgacgcagacgagatcttcccgacactgcaacagatcgtgtccgaa accctgcgcgtgcccatcgagcaggtgacccgcgaatccgcgctgtccgacctcggcatg gtcgaatccatcaaactgctgcgggtcgccgggaagatcgagcggcgcttcgacatcgaa ctcgacgacagcctcttcttccagggcgtctccatgggccggctggtggacgagatagcc gcccagcgcgccgcggccgtctccggggaggccgcgtga

DBGET integrated database retrieval system