Streptomyces halobius: K9S39_30180 Help Entry K9S39_30180       CDS       T09588                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shau  Streptomyces halobius Pathway shau00998   Biosynthesis of various antibiotics shau01100   Metabolic pathways shau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K9S39_30180    00074 Mycolic acid biosynthesis     K9S39_30180   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K9S39_30180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UQA95557 UniProt:  A0ABY4MDT7 LinkDB All DBs Position complement(6641204..6641452) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQADKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYIIKNQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacccaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccaggcggacaagtccttcaccgatgacctggacgtcgac tcactgtccatggtcgaggtcgtcgtcgcggccgaggagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcatcaagaac cagagctga

DBGET integrated database retrieval system