Streptomyces hawaiiensis: CEB94_22245 Help Entry CEB94_22245       CDS       T06917                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism shaw  Streptomyces hawaiiensis Pathway shaw00261   Monobactam biosynthesis shaw01100   Metabolic pathways shaw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shaw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CEB94_22245  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:shaw01008]     CEB94_22245 Polyketide biosynthesis proteins [BR:shaw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CEB94_22245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QCD60711 UniProt:  A0A6G5RS92 LinkDB All DBs Position 4749717..4749938 Genome browser AA seq 73 aa AA seqDB search MSAAEDRYLVVVNHEEQYSIWLADRDIPMGWRPVGEAGTKRECLAHIEHVWTDLTPLSVR MSLSEPAAKDPSR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagtgctgcggaagaccgctacctggtcgtcgtcaaccacgaggagcagtactcgatc tggctcgccgaccgtgacatccccatgggctggcggccggtgggcgaggccggcacgaag cgggaatgcctcgcccacatagagcacgtgtggaccgacctgaccccgctgtccgtccgt atgtccctgtccgagccggcggccaaggacccgtcgcgatga

DBGET integrated database retrieval system