Staphylothermus hellenicus: Shell_1385 Help Entry Shell_1385        CDS       T01249                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism shc  Staphylothermus hellenicus Pathway shc03060   Protein export shc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:shc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Shell_1385    04141 Protein processing in endoplasmic reticulum     Shell_1385  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Shell_1385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shc04131]     Shell_1385   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:shc02044]     Shell_1385 Membrane trafficking [BR:shc04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     Shell_1385 Secretion system [BR:shc02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    Shell_1385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  ADI32474 UniProt:  D7D9M8 LinkDB All DBs Position complement(1341905..1342093) Genome browser AA seq 62 aa AA seqDB search MGFRELIDSWRRIIRLATKPNKTEYMTSLKISLLGLTLVGSIAFIVRFIFISFIFPQQLY GG NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgggttttagagaattaatagattcgtggcgaagaataatacggttggcgactaagcct aataaaacagagtatatgactagtttaaagataagcctgttaggattaactcttgtgggt tcaatagctttcatagttagattcatatttatatcatttatatttccacagcaattatat ggaggctaa

DBGET integrated database retrieval system