Staphylothermus hellenicus: Shell_1630 Help Entry Shell_1630        CDS       T01249                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism shc  Staphylothermus hellenicus Pathway shc03010   Ribosome Brite KEGG Orthology (KO) [BR:shc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Shell_1630   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Shell_1630  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:shc03011]     Shell_1630    04121 Ubiquitin system [BR:shc04121]     Shell_1630   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shc04147]     Shell_1630 Ribosome [BR:shc03011]  Ribosomal proteins   Eukaryotes    Small subunit     Shell_1630   Archaea     Shell_1630 Ubiquitin system [BR:shc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Shell_1630 Exosome [BR:shc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Shell_1630   Exosomal proteins of colorectal cancer cells    Shell_1630 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_RPB9 Zn_ribbon_Nudix Zn_ribbon_IS1595 Zn_ribbon_3 IBR Zn_ribbon_PriA DUF7479 TackOD1 Zn_Ribbon_1 Ribosomal_L37ae EDR4-like_1st DZR Zn_ribbon_TOP3B DUF1451 A2L_zn_ribbon Zn_ribbon_recom Lar_restr_allev Baculo_ME53 Zn_ribbon_TFIIB zf_UBZ Motif Other DBs NCBI-ProteinID:  ADI32715 UniProt:  D7DAB9 LinkDB All DBs Position complement(1548757..1548921) Genome browser AA seq 54 aa AA seqDB search MAYVHKLYIFDYKTGTIKPKNKKCPKCGSFMAFHKKPVPRWHCGKCGYVEYVQE NT seq 165 nt NT seq  +upstreamnt  +downstreamnt gtggcgtacgtccataaactctatatattcgactataagactggaacaataaagcctaaa aacaagaaatgccccaaatgcggtagctttatggcgttccacaagaaacctgtgcctaga tggcactgcggtaaatgtggatatgtagaatatgtacaggaataa

DBGET integrated database retrieval system