Sulfuritalea hydrogenivorans: SUTH_00996 Help Entry SUTH_00996        CDS       T03591                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shd  Sulfuritalea hydrogenivorans Pathway shd01100   Metabolic pathways shd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SUTH_00996    00074 Mycolic acid biosynthesis     SUTH_00996   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SUTH_00996 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding NTE_Ploop Motif Other DBs NCBI-ProteinID:  BAO28802 UniProt:  W0SD19 LinkDB All DBs Position 1021505..1021744 Genome browser AA seq 79 aa AA seqDB search MNKRLTALLADVFRLRESEIHPDLKKADVGSWDSLKQMDLVMSLEGEYGIVLMIPDIVRM VSVAGIVAVLKEKGVDLAD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacgattgacagctctgttggccgacgtgtttcgtttgcgcgaatccgagatt catccggacctgaaaaaggccgacgtgggaagttgggactcactgaaacagatggacctg gtgatgtccctggaaggcgaatacgggatcgtgctgatgatccccgacatcgttcgcatg gtgtccgtcgccggtatcgtcgccgtgctgaaggagaagggagtcgatcttgcggattga

DBGET integrated database retrieval system