Sulfuritalea hydrogenivorans: SUTH_03625 Help Entry SUTH_03625        CDS       T03591                                  Name (GenBank) ATP synthase subunit c AtpE   KO K02110   F-type H+-transporting ATPase subunit c Organism shd  Sulfuritalea hydrogenivorans Pathway shd00190   Oxidative phosphorylation shd01100   Metabolic pathways Module shd_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:shd00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SUTH_03625  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:shd00194]     SUTH_03625 Photosynthesis proteins [BR:shd00194]  Photosystem and electron transport system   F-type ATPase [OT]    SUTH_03625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BAO31395 UniProt:  W0SL99 LinkDB All DBs Position complement(3791871..3792128) Genome browser AA seq 85 aa AA seqDB search MEQMVGFVALAAGLIIGLGAAGACIGIGIMGSRFLEASARQPELMNTLQTKMFLLVGLID AAFIIGTGIALWYTTANPFLSGLAK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaacaaatggttggttttgttgctcttgctgccggtctgatcatcggtcttggcgcc gctggcgcgtgtatcggcatcggcatcatgggtagccgcttcctcgaagcttccgcgcgt cagccggaactgatgaacacgctgcaaaccaaaatgttcctgctggtcggcctgatcgac gccgcgttcattatcggtaccggtattgccctgtggtacaccacggccaacccgttcctc tccggcctggccaagtaa

DBGET integrated database retrieval system