Shewanella sp. MR-4: Shewmr4_1241 Help Entry Shewmr4_1241      CDS       T00388                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism she  Shewanella sp. MR-4 Pathway she00190   Oxidative phosphorylation she01100   Metabolic pathways she02020   Two-component system Module she_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:she00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Shewmr4_1241  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Shewmr4_1241 Enzymes [BR:she01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Shewmr4_1241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABI38321 LinkDB All DBs Position 1449457..1449573 Genome browser AA seq 38 aa AA seqDB search MWYFTWILGVLLACSFGVINALWLENTENMDRSSDDAE NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacgtggatattaggggttttgttagcctgttcttttggtgtgatcaac gccctgtggcttgaaaacacggagaacatggaccgctcaagcgatgacgctgagtaa

DBGET integrated database retrieval system