KEGG   Shewanella sp. MR-4: Shewmr4_2486
Entry
Shewmr4_2486      CDS       T00388                                 
Name
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K19228  cationic peptide transport system permease protein
Organism
she  Shewanella sp. MR-4
Pathway
she01503  Cationic antimicrobial peptide (CAMP) resistance
she02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:she00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Shewmr4_2486
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Shewmr4_2486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:she02000]
    Shewmr4_2486
Transporters [BR:she02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    Shewmr4_2486
SSDB
Motif
Pfam: BPD_transp_1 OppC_N DUF6163
Other DBs
NCBI-ProteinID: ABI39557
LinkDB
Position
2954427..2955317
AA seq 296 aa
MPPIKIYQEDQIASPMMRVWQNFSANPFALAGLWTIAFLLLLTLFGPMIAPFSPEAQDPR
ALLLPPSWDPSGTVAHFLGTDDLGRDIFSRLLHGAHLTFGMALMIVGTALFMGFIIGSLS
GMMRGLKSSILGHLLDALLSIPSLLMAILVVAVMGPGLENVFWAVGIALTPQFVRSIHQS
VHEELQKEYVTAARLDGANSLQIFWYVIMPNVWEVVIIQTTLAISAAILDIAALGFLSLG
AQAPSPEWGAMVAQGMDNLLTAPWTVTIPGLAILFSVLAINLVGDGLRSALAPIRN
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcctccaattaaaatttatcaggaagatcaaattgcctcgccgatgatgcgggtctgg
cagaatttttcggcaaacccctttgccttagcgggtctgtggaccattgcttttctgctg
ctgctcaccctgttcggaccaatgattgcccccttctcccctgaggcgcaggatccacgg
gcattactgttaccgccctcttgggacccttcgggcacagtggcgcactttttggggacc
gacgatctgggtcgtgacatttttagccgcttgctgcatggggcacatttaaccttcggc
atggcgctgatgattgtcggtactgcattgtttatggggttcatcatcggctcgctctcc
ggcatgatgcgtggcttaaaatccagtattttggggcacttgctcgatgcattactgtct
atcccttcactattaatggcgattttagtggttgccgtcatggggccagggcttgaaaac
gtcttctgggccgtgggcattgccttaacgccacagtttgtacgctccattcatcaatcg
gtacatgaagagttacagaaagaatatgtgactgcggcccgtttagacggtgccaattcg
ctgcagattttttggtatgtgatcatgccaaacgtctgggaagtggtgattattcaaacc
acgttagctatttctgccgcgattttagatattgccgcccttggctttttaagccttggc
gcccaagctcctagtcctgaatggggtgcaatggttgcccaaggtatggataatttgttg
accgcaccttggactgtgaccattccagggctggcgattctttttagtgtgctcgccatt
aacttggtgggcgatggcttgagatcggcgcttgcgcccatcagaaactaa

DBGET integrated database retrieval system