Shewanella sp. Arc9-LZ: GUY17_12895 Help Entry GUY17_12895       CDS       T10509                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shea  Shewanella sp. Arc9-LZ Pathway shea01100   Metabolic pathways shea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GUY17_12895 (acpP)    00074 Mycolic acid biosynthesis     GUY17_12895 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GUY17_12895 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB EutQ DUF7966 DUF1896 Motif Other DBs NCBI-ProteinID:  QHS13949 LinkDB All DBs Position complement(3011040..3011273) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKSAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcatcatcgaacaacttggcgttaaagaa gaagacgttaaatcagctgcttcttttgtagacgatttaggcgctgattctctagacact gttgaattggttatggctctagaagaagagtttgataccgagatccctgacgaagaagct gaaaagatcactactgttcaagcagcgatcgattacgtttctaagaatcagtaa

DBGET integrated database retrieval system