Shewanella sp. H8: ABIS04_01575 Help Entry ABIS04_01575      CDS       T10623                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sheh  Shewanella sp. H8 Pathway sheh01100   Metabolic pathways sheh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sheh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABIS04_01575    00074 Mycolic acid biosynthesis     ABIS04_01575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABIS04_01575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XBJ48906 LinkDB All DBs Position complement(360782..361030) Genome browser AA seq 82 aa AA seqDB search MQNREQILEMLSGILVEEFEIEATDITLEASLYEDLDLDSIDAVDLVIKLQQLTGKKIQP EAFKTVRSVSDVVNAIEGLIKS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaatccttgagatgcttagtggtattttagttgaagagtttgaa atagaagcgacagatatcactctagaagcttctttgtatgaagatctagatttagacagt attgatgcggtagatttggtgattaaattgcaacagctgacgggtaaaaaaattcagcca gaagcatttaaaaccgtacgttcagtgagcgatgtcgttaatgctattgaaggcttaatt aaaagctaa

DBGET integrated database retrieval system