Shewanella sp. JNE2: MZ182_07780 Help Entry MZ182_07780       CDS       T08546                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shej  Shewanella sp. JNE2 Pathway shej01100   Metabolic pathways shej01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shej00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MZ182_07780 (acpP)    00074 Mycolic acid biosynthesis     MZ182_07780 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MZ182_07780 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB HLH Motif Other DBs NCBI-ProteinID:  UPO32721 LinkDB All DBs Position 1743559..1743792 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVKEEDVKPAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcattgtagagcaactgggcgttaaagaa gaagacgttaagccagcggcatctttcgttgacgatctgggtgcagattctctggacact gttgagttggttatggctctagaagaagagtttgataccgagatccctgatgaagaagct gaaaagatcactactgttcaagcagcgatcgactacgtttctaagaatcagtaa

DBGET integrated database retrieval system