Shewanella sp. LZH-2: JM642_17915 Help Entry JM642_17915       CDS       T10525                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism shel  Shewanella sp. LZH-2 Brite KEGG Orthology (KO) [BR:shel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:shel03032]     JM642_17915    03036 Chromosome and associated proteins [BR:shel03036]     JM642_17915    03400 DNA repair and recombination proteins [BR:shel03400]     JM642_17915 DNA replication proteins [BR:shel03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JM642_17915 Chromosome and associated proteins [BR:shel03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JM642_17915 DNA repair and recombination proteins [BR:shel03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JM642_17915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  QRK79119 LinkDB All DBs Position 4076735..4077007 Genome browser AA seq 90 aa AA seqDB search MNKTELIAKIAENADITKAEAARALKSFEAAITESMKNGDKISIVGFGSFETATRAARTG RNPQTGKEIQIAEATVPKFKAGKTLRDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgaacttatcgccaaaattgcagaaaatgccgatatcactaaagctgaa gcagcacgagcattgaaatctttcgaagcggcgattactgaatcaatgaaaaacggtgac aaaatctctatcgtcggatttggctcctttgaaacagcgactcgtgcagctcgtactggt cgtaacccacaaacgggcaaagaaatccaaattgcggaagcgactgtacctaagtttaaa gcgggtaaaaccctgcgtgatagtgtgaactaa

DBGET integrated database retrieval system