KEGG   Shewanella sp. MTB7: HWQ47_01115
Entry
HWQ47_01115       CDS       T10730                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
shem  Shewanella sp. MTB7
Pathway
shem00770  Pantothenate and CoA biosynthesis
shem01100  Metabolic pathways
shem01240  Biosynthesis of cofactors
Module
shem_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:shem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HWQ47_01115 (coaD)
Enzymes [BR:shem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     HWQ47_01115 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: WBJ95769
LinkDB
Position
245806..246282
AA seq 158 aa
MHKRAIYPGTFDPVTNGHTDLIERAAKLFKHVVIGIAANPSKLPRFSLDERVQLLKLVTA
HLDNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLESVFLTP
SEENSFISSTLVKEVALHGGDVSQFVHPQVSKALLSKG
NT seq 477 nt   +upstreamnt  +downstreamnt
atgcataaacgagcaatatatccagggacctttgatcccgtgacaaatggacataccgac
cttatcgaaagggccgctaagctatttaaacatgtagtgattggtatagcggctaatcca
tctaagctgcctaggtttagcttagatgagcgagttcaactacttaaactggtgactgcc
catctcgataatgtcgaggttgttggtttcagtggtttgttagtggactttgctaaagaa
caaaaagcgagtgtgctagttcgagggttaagggcggtgtctgattttgaatatgaattt
cagttagcgaatatgaatcgtcgtttgagccctgatctagagagcgtatttttaacacca
tcggaggagaattcgtttatctcctcgaccttagttaaagaggtggcgctacatggtggt
gatgtcagtcagtttgttcaccctcaagtgagcaaagcacttttaagcaaaggataa

DBGET integrated database retrieval system