Shewanella sp. MTB7: HWQ47_01805 Help Entry HWQ47_01805       CDS       T10730                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shem  Shewanella sp. MTB7 Pathway shem01100   Metabolic pathways shem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWQ47_01805    00074 Mycolic acid biosynthesis     HWQ47_01805   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWQ47_01805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD DIMCO_N Motif Other DBs NCBI-ProteinID:  WBJ98060 LinkDB All DBs Position complement(405664..405906) Genome browser AA seq 80 aa AA seqDB search MQSREQILEALTQILVDDFEIDAEDITPEASLYQDLDLDSIDAVDLVIKLQQMTGKKIKP EEFKAVRTVNDVVTAIEGLV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcaaagtcgtgagcaaattcttgaagcgctaacacagatcttagttgatgattttgag atagatgccgaggatataacccctgaagcatcactctaccaagatcttgatctagacagt atagatgcggtcgatttagtgattaagctgcaacagatgacgggcaagaaaattaaaccc gaagagttcaaggctgtacgcaccgtcaatgacgtagtgaccgctatcgaaggactcgta taa

DBGET integrated database retrieval system