Shewanella sp. Pdp11: AYJ58_00965 Help Entry AYJ58_00965       CDS       T11329                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shep  Shewanella sp. Pdp11 Pathway shep01100   Metabolic pathways shep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYJ58_00965    00074 Mycolic acid biosynthesis     AYJ58_00965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYJ58_00965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUD58145 LinkDB All DBs Position 215734..215988 Genome browser AA seq 84 aa AA seqDB search MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDALELGLAIKKKFDVKIEA NSDATKAHFHSVASLASFIESQRP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacttaaacaatgaaataaagcagttaatcatcgactgcctcgatcttgaagacgtc agtattgatgatattgaaaccgatgcaccgctctttggcgaaggtctaggcttagattct atcgacgccctcgaactcggcttagccatcaagaaaaaatttgatgttaaaatcgaagcg aactcggatgccactaaggcccatttccacagtgttgccagcttagctagctttatcgaa tcccagcgtccatag

DBGET integrated database retrieval system