Shewanella sp. Pdp11: AYJ58_00970 Help Entry AYJ58_00970       CDS       T11329                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shep  Shewanella sp. Pdp11 Pathway shep01100   Metabolic pathways shep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYJ58_00970    00074 Mycolic acid biosynthesis     AYJ58_00970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYJ58_00970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  AUD58146 LinkDB All DBs Position 215998..216246 Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIEAEAITPEANLYEELDLDSIDAVDLVIKLQQMTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaatcctcgccatgctgaccactattttagtggacgaattcgaa attgaggctgaggcaattacgcctgaagccaacctgtatgaagagctcgatctcgacagt attgatgccgtcgacttagtgataaagctgcaacaaatgacaggtaaaaagatccaaccc gatgaatttaaatccgttcgcacagtcaacgatgtggtgaatgccatcgaaggtttagtt aaagactaa

DBGET integrated database retrieval system