Shewanella sp. WE21: CKQ84_04800 Help Entry CKQ84_04800       CDS       T05404                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism shew  Shewanella sp. WE21 Brite KEGG Orthology (KO) [BR:shew00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:shew03032]     CKQ84_04800    03036 Chromosome and associated proteins [BR:shew03036]     CKQ84_04800    03400 DNA repair and recombination proteins [BR:shew03400]     CKQ84_04800 DNA replication proteins [BR:shew03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CKQ84_04800 Chromosome and associated proteins [BR:shew03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CKQ84_04800 DNA repair and recombination proteins [BR:shew03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CKQ84_04800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AVI65254 LinkDB All DBs Position 1123357..1123629 Genome browser AA seq 90 aa AA seqDB search MNKTELIAKIAENADLTKVEAARALKSFEAAITESMKNGDKISIVGFGSFETATRAARTG RNPQTGKEIQIAEATVPKFKAGKTLRDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgaactaatcgccaaaattgcagaaaatgccgatctaacgaaagtagaa gcagcacgcgcattgaagtcttttgaagcagctattaccgaatcaatgaaaaatggtgac aaaatctccatcgtaggtttcggttcttttgaaacagcgactcgtgccgctcgcactggc cgtaacccacaaacgggtaaagaaattcaaattgctgaagcgacagtgcctaagtttaaa gcaggtaaaaccctacgtgacagcgtaaactaa

DBGET integrated database retrieval system