Shewanella sp. WE21: CKQ84_09360
Help
Entry
CKQ84_09360 CDS
T05404
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
shew
Shewanella sp. WE21
Pathway
shew03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
shew00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
CKQ84_09360
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
shew03011
]
CKQ84_09360
Ribosome [BR:
shew03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
CKQ84_09360
Bacteria
CKQ84_09360
Archaea
CKQ84_09360
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
Motif
Other DBs
NCBI-ProteinID:
AVI66058
LinkDB
All DBs
Position
2190425..2190775
Genome browser
AA seq
116 aa
AA seq
DB search
MDKKTSRLRRATRARKKIQELGVNRLVVHRTPRHIYAQVINPEAQVLAAASTVEKAVKEL
LKSTGNVDAAKAVGKFVAERAIEKGVTSVAFDRSGFKYHGRVAALADAAREAGLKF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaaacatctcgcttacgtcgcgctactcgcgctcgtaagaagatccaagag
ctgggcgtgaaccgtctggttgtacatcgtacaccgcgtcacatttatgctcaggtgatc
aatcctgaagctcaggtgttggcagctgcttcaaccgtagaaaaagcggttaaagagcta
ctgaagagtaccggtaacgtagacgcagcgaaagcagtaggtaaatttgttgctgagcgc
gcgatcgaaaaaggcgtaacttcagttgcgttcgatcgttctggtttcaagtatcacggt
cgtgtagctgctttagcagatgcagctcgtgaagctggcctgaagttctaa
DBGET
integrated database retrieval system