Shewanella sp. WE21: CKQ84_10080 Help Entry CKQ84_10080       CDS       T05404                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shew  Shewanella sp. WE21 Pathway shew01100   Metabolic pathways shew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shew00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CKQ84_10080    00074 Mycolic acid biosynthesis     CKQ84_10080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CKQ84_10080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD InlK_D2 Motif Other DBs NCBI-ProteinID:  AVI66192 LinkDB All DBs Position complement(2330254..2330502) Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIDAEAITPEANLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTINDVINAIEGLVRT NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaatcctcgctatgctgaccactattttagtggacgaattcgaa attgatgccgaggcgattacgcctgaggccaacctgtatgaagagctcgatctcgacagt attgatgcagtcgacttagtgataaaactgcagcaactgacaggtaaaaagatccaaccc gatgaatttaaatcagttcgcacaatcaacgatgtgattaatgctatcgaaggtttagtg agaacctaa

DBGET integrated database retrieval system