Shewanella sp. FDAARGOS_354: CEQ32_02565 Help Entry CEQ32_02565       CDS       T04944                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shf  Shewanella sp. FDAARGOS_354 Pathway shf01100   Metabolic pathways shf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEQ32_02565    00074 Mycolic acid biosynthesis     CEQ32_02565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEQ32_02565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 HLH Motif Other DBs NCBI-ProteinID:  ASF14026 LinkDB All DBs Position 550546..550779 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVKEEDVKPAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcattgtagagcaactgggcgttaaagaa gaagacgttaaaccagcggcatctttcgttgacgatctgggtgcagattctctggacact gttgagttggttatggctctggaagaagagtttgataccgagatccctgatgaagaagct gaaaagatcactactgttcaagcagcgatcgattacgtttctaagaatcagtaa

DBGET integrated database retrieval system