Shewanella sp. FDAARGOS_354: CEQ32_18145 Help Entry CEQ32_18145       CDS       T04944                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shf  Shewanella sp. FDAARGOS_354 Pathway shf01100   Metabolic pathways shf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEQ32_18145    00074 Mycolic acid biosynthesis     CEQ32_18145   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEQ32_18145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASF16733 LinkDB All DBs Position complement(4032158..4032412) Genome browser AA seq 84 aa AA seqDB search MTLHNEIKQLIIDCLDLEDVSIDDIETDAPLFGDGLGLDSIDALELGLAIKKKFDVKIEA NSDSTKAHFYSVASLAKFIESQRP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgactttacacaacgaaattaaacagttaattatcgactgcctcgacctagaagatgtc agtattgatgatattgaaaccgatgcgcccctatttggtgacggactcggactcgattct atcgacgccctcgagttaggtttagccatcaagaaaaagtttgatgtcaaaatcgaagcc aactcggatagcactaaggcgcatttttacagtgtggccagcctcgctaaatttatcgaa tcacagcgcccatag

DBGET integrated database retrieval system