KEGG   Slackia heliotrinireducens: Shel_07930
Entry
Shel_07930        CDS       T00981                                 
Name
(GenBank) Fe-S-cluster-containing hydrogenase subunit
  KO
K00184  dimethyl sulfoxide reductase iron-sulfur subunit
Organism
shi  Slackia heliotrinireducens
Pathway
shi00920  Sulfur metabolism
shi01100  Metabolic pathways
shi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shi00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Shel_07930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shi02000]
    Shel_07930
Transporters [BR:shi02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   Shel_07930
SSDB
Motif
Pfam: Fer4_11 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_8 Fer4 Fer4_6 Fer4_17 Fer4_4 Fer4_3 Fer4_21 Fer4_16 Fer4_20
Other DBs
NCBI-ProteinID: ACV21849
UniProt: C7N4L4
LinkDB
Position
complement(917872..918510)
AA seq 212 aa
MTKYAIVVDEHRCIGCWSCSVACKLENNLPDQSWWNTVLTVGGDSVNTPAGEYGKNTITF
NPYHCMHCDTPACTAVCPTGATYKDEETGIVMQNVSECIGCRSCIEACPYTGVRTYLEED
PIPAMEWPVGNQQAPDHLVNTVEKCIMCYYRVKDGKDPACVEGCPAYARVFGDLDDPESE
VSKLLAEREYYVLNPEAGTGPNVYYLKDTTQR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaccaagtacgccattgtcgttgacgagcaccgttgcatcggttgctggtcctgcagc
gttgcctgcaaactcgagaacaacctccccgatcagtcctggtggaacaccgtgctgacc
gtgggcggcgacagtgtgaacactcctgccggcgaatacggcaagaacaccatcaccttc
aatccgtaccactgcatgcattgcgacaccccggcctgcaccgccgtgtgcccgaccggc
gccacctacaaggatgaggaaaccggcatcgtcatgcagaacgtgtccgagtgcatcggc
tgccgcagctgcatcgaggcttgcccctacacgggcgtccgcacctacctggaagaggac
cccattcccgccatggagtggcctgtcggcaaccagcaggcacccgaccacctggtcaac
accgtcgagaagtgcatcatgtgctactaccgcgtgaaggacggcaaggaccccgcatgc
gtcgagggctgccccgcctacgcccgcgtcttcggcgatttggacgaccccgaaagcgaa
gtgtccaagcttctggccgagcgcgagtactacgtgctcaaccccgaagccggcaccggc
ccgaacgtgtattaccttaaagacaccacgcagcgctaa

DBGET integrated database retrieval system