Shigella sp. PIB: LXH19_05150 Help Entry LXH19_05150       CDS       T10707                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism shig  Shigella sp. PIB Brite KEGG Orthology (KO) [BR:shig00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shig03036]     LXH19_05150 (ftsB) Chromosome and associated proteins [BR:shig03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LXH19_05150 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC XRCC4_CC Motif Other DBs NCBI-ProteinID:  USJ83100 LinkDB All DBs Position 1084285..1084596 Genome browser AA seq 103 aa AA seqDB search MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDL NGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggtaaactaacgctgctgttgctggctattctggtctggctacagtattcgctgtgg ttcggtaagaacggtatacatgactatacccgcgtcaatgatgatgtggcggcacagcaa gctacaaacgcgaaacttaaagcgcgaaacgatcaactttttgccgaaattgacgatctc aatggcggccaggaggcgctcgaagagcgtgcgcgtaatgaactcagcatgaccaggccg ggcgaaactttttatcgtctggtgcctgacgcgtcgaagcgcgcacagtctgcggggcaa aacaatcgataa

DBGET integrated database retrieval system