Salvia hispanica (chia): 125209037 Help Entry 125209037         CDS       T09851                                  Name (RefSeq) glutaredoxin-C3-like   KO K00128   aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] Organism shis  Salvia hispanica (chia) Pathway shis00010   Glycolysis / Gluconeogenesis shis00053   Ascorbate and aldarate metabolism shis00071   Fatty acid degradation shis00280   Valine, leucine and isoleucine degradation shis00310   Lysine degradation shis00330   Arginine and proline metabolism shis00340   Histidine metabolism shis00380   Tryptophan metabolism shis00410   beta-Alanine metabolism shis00561   Glycerolipid metabolism shis00620   Pyruvate metabolism shis00770   Pantothenate and CoA biosynthesis shis01100   Metabolic pathways shis01110   Biosynthesis of secondary metabolites shis01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:shis00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     125209037    00053 Ascorbate and aldarate metabolism     125209037    00620 Pyruvate metabolism     125209037   09103 Lipid metabolism    00071 Fatty acid degradation     125209037    00561 Glycerolipid metabolism     125209037   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     125209037    00310 Lysine degradation     125209037    00330 Arginine and proline metabolism     125209037    00340 Histidine metabolism     125209037    00380 Tryptophan metabolism     125209037   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     125209037   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     125209037   09109 Metabolism of terpenoids and polyketides    00903 Limonene degradation     125209037 Enzymes [BR:shis01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.1  With NAD+ or NADP+ as acceptor     1.2.1.3  aldehyde dehydrogenase (NAD+)      125209037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 DSBA GST_N_3 Motif Other DBs NCBI-GeneID:  125209037 NCBI-ProteinID:  XP_047964578 LinkDB All DBs Position 3:complement(51918351..51920648) Genome browser AA seq 193 aa AA seqDB search MNASSKPLQLVHLPSSTRLPTRSNFYRGVNLIPRRFNLQLSCICESQLRRCGNDAVAGEL MMFGAGLQRRSALIAAVACILVIGNAPHKTLASNSPSAFVENVIYSNKIAIFSKSYCPYS LRAKRVFSELEEQPYVVELDLRDDGYKIQDVLLELVGRRTVPQVFVNGKHIGGSDDLQAA VKSGKLQSLLSKA NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgaacgcttcgtcaaagccccttcagctggtccacttaccttcttcaacgcggctccct acacgctccaatttctacagaggtgtgaatttgattccgagaaggtttaatctgcaattg agctgtatctgcgaatcccagctgcgaaggtgtggaaacgacgccgttgcgggcgagttg atgatgtttggagctggtttgcagcggcgatcagctctgattgccgcggtggcttgtatt ttggtgatcggcaatgcgccccataaaaccctagcttccaattcgccgtcggcttttgtc gaaaatgttatttattctaataaaattgccattttctccaaatcatattgcccatattcc ttgcgagccaagcgcgtatttagtgaactcgaggagcagccctatgtcgtggagcttgat cttcgggatgacggatataagattcaggacgttctcctggaattggttgggcgacgaact gtcccacaagtgtttgtaaatgggaagcatattggcggttctgatgatctgcaagctgct gttaaaagtggtaaactgcagagccttctcagtaaagcttga

DBGET integrated database retrieval system