Salvia hispanica (chia): 125214884 Help Entry 125214884         CDS       T09851                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism shis  Salvia hispanica (chia) Pathway shis04145   Phagosome shis04148   Efferocytosis shis04620   Toll-like receptor signaling pathway shis05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:shis00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     125214884    04148 Efferocytosis     125214884  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125214884  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     125214884  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shis04131]     125214884   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shis04147]     125214884    04031 GTP-binding proteins [BR:shis04031]     125214884 Membrane trafficking [BR:shis04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     125214884  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     125214884   Macropinocytosis    Ras GTPases     125214884  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     125214884 Exosome [BR:shis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125214884   Exosomal proteins of other body fluids (saliva and urine)    125214884   Exosomal proteins of colorectal cancer cells    125214884   Exosomal proteins of bladder cancer cells    125214884 GTP-binding proteins [BR:shis04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     125214884 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  125214884 NCBI-ProteinID:  XP_047972049 LinkDB All DBs Position 3:complement(28660608..28664040) Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPITTAQGEDLKKSIGAAAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttctaggtttattaagtgcgtgacggtgggcgacggagctgtggggaaaact tgcttgctcatttcttacactagcaacacttttcccactgattatgtcccgactgttttc gataatttcagtgccaatgtcgttgtggacggaagcactgttaatttgggattgtgggat actgctggtcaagaggattacaacagattgagaccgttgagctaccgtggagctgatgtc ttcatactcgccttctctcttattagcaaggccagctacgagaatgtctctaagaagtgg attcctgaattaaggcattatgcacctggagttccaataatccttgtggggacaaagctt gatcttcgagaggataagcagttctttgtggaccacccgggagcagtgcccattacgaca gcacagggagaggacttgaagaaatcgattggagctgctgcttacatcgaatgcagtgct aagacacaacagaatgtgaaagctgtcttcgatgcagcaatcaaggttgttctgcagcca cccaagcaaaagaagaaaaagaagagaaagggccaaaaggcttgcagcatattataa

DBGET integrated database retrieval system