Salvia hispanica (chia): 125220041 Help Entry 125220041         CDS       T09851                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism shis  Salvia hispanica (chia) Pathway shis03018   RNA degradation shis03040   Spliceosome Brite KEGG Orthology (KO) [BR:shis00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     125220041   09123 Folding, sorting and degradation    03018 RNA degradation     125220041  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:shis03019]     125220041    03041 Spliceosome [BR:shis03041]     125220041 Messenger RNA biogenesis [BR:shis03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      125220041   mRNA degradation factors    5'-3' decay     Lsm complex      125220041 Spliceosome [BR:shis03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     125220041  Complex C   U2 snRNP components     125220041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C Motif Other DBs NCBI-GeneID:  125220041 NCBI-ProteinID:  XP_047978111 LinkDB All DBs Position 4:25990400..25992183 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDVELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcgtatttcaaggatttggtggggagggaagtgacggtggaattgaag aatgatttagcgattagagggactctgcattcggtggatcagtacctcaacattaagctg gagaatactagggttgttgatcaggacaagtatccccatatgctttcagtgcgaaactgc ttcatccggggatctgtggtccgatacgtccaattgccgcctgagggagttgatgtggag cttctgcatgatgcgactagaagagaagcacgcggcggctag

DBGET integrated database retrieval system