Streptomyces huasconensis: J2N69_20425 Help Entry J2N69_20425       CDS       T07920                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shk  Streptomyces huasconensis Pathway shk00998   Biosynthesis of various antibiotics shk01100   Metabolic pathways shk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J2N69_20425    00074 Mycolic acid biosynthesis     J2N69_20425   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J2N69_20425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UFQ17181 LinkDB All DBs Position 4472683..4472925 Genome browser AA seq 80 aa AA seqDB search MVEITPDLRDRVKKIVCDILEVEPGELTETTHFYEELGVDSLAVIEIMTAIEDSLGITIE QDKAKRMVSLAAIHDVLAEA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggagatcacgcccgacctgcgggaccgcgtcaagaagatcgtctgcgacatcctg gaggtcgagcccggcgaactcacggagacgacgcacttctacgaggagctcggcgtcgac tccctggccgtcatcgagatcatgacggccatcgaggacagcctgggcatcaccatcgaa caggacaaggccaagcgcatggtgagcctggccgcgatccacgacgtcctggccgaagca tga

DBGET integrated database retrieval system