Streptomyces huasconensis: J2N69_35945 Help Entry J2N69_35945       CDS       T07920                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism shk  Streptomyces huasconensis Pathway shk01051   Biosynthesis of ansamycins shk01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:shk00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     J2N69_35945    01051 Biosynthesis of ansamycins     J2N69_35945  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:shk01008]     J2N69_35945 Polyketide biosynthesis proteins [BR:shk01008]  Polyketide tailoring proteins   Others    J2N69_35945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UFQ19923 LinkDB All DBs Position complement(8086675..8086956) Genome browser AA seq 93 aa AA seqDB search MSEPTTTPPLSAEHVRTELRRFLEERTKTDWAADTDLFATGGVSSLFAMELVVHVEKTFG IAVEGPDLRIDNFRTVNAMTDLVLRLAEAGSGE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgagcgagcccaccaccacccctcccctgtcggcggagcacgtcaggaccgagctgcgg cggttcctggaggagcgcaccaagaccgactgggcggcggacaccgacctcttcgcgacc ggcggggtctcctccctgttcgccatggagctggtggtccacgtcgagaagaccttcggc atcgccgtcgagggccccgacctgcgcatcgacaacttccgtacggtcaacgccatgacg gacctggtgctccggctcgccgaagcgggctccggtgagtga

DBGET integrated database retrieval system