Shewanella halifaxensis: Shal_0380 Help Entry Shal_0380         CDS       T00654                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism shl  Shewanella halifaxensis Pathway shl01100   Metabolic pathways shl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Shal_0380    00074 Mycolic acid biosynthesis     Shal_0380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Shal_0380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD DUF7943 Motif Other DBs NCBI-ProteinID:  ABZ74955 UniProt:  B0TPT4 LinkDB All DBs Position complement(446676..446924) Genome browser AA seq 82 aa AA seqDB search MQSREQILEMLTQILVEEFEVDAEEITPEASLYEELDLDSIDAVDLVIKLQQMTGKKIKP EEFKAVRTVNDVVSAIEGLVKE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaagtcgtgaacagatcctagagatgctgactcagatcctcgtcgaagaatttgaa gttgatgccgaagagatcaccccagaagcttctctatacgaagagctcgatcttgacagc atcgatgccgtcgatttggtgattaagctgcagcagatgacaggcaagaagattaagcct gaagagtttaaagcggttagaaccgttaatgacgtcgtctcggctatcgaaggcttagtc aaagagtaa

DBGET integrated database retrieval system