Shewanella halifaxensis: Shal_1423 Help Entry Shal_1423         CDS       T00654                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism shl  Shewanella halifaxensis Pathway shl02020   Two-component system shl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:shl00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Shal_1423  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Shal_1423  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:shl02035]     Shal_1423 Bacterial motility proteins [BR:shl02035]  Flagellar system   Flagellar assembly proteins    Others     Shal_1423 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF6707 PqqD Motif Other DBs NCBI-ProteinID:  ABZ75989 UniProt:  B0TMC0 LinkDB All DBs Position complement(1720691..1721005) Genome browser AA seq 104 aa AA seqDB search MAIDIKQINPHTNTRIGTGSNAKNAAVQTPATPAPTIQKSDSVSITAQAQQIQNVQTKMA DMPEIDQKKVDEIKAAIAEGRYKIDPEKLATNIANFENELKDLS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggctattgatattaaacaaataaaccctcataccaatacacgtatcggtacgggttct aatgcaaaaaatgcagcggttcaaacacccgcaactcctgcgccaacgattcagaaaagt gattctgtttcgattaccgcacaggctcaacagattcaaaacgtacaaactaagatggcc gacatgcctgaaatagaccaaaagaaagtcgacgaaattaaagcagcaattgctgaaggg cgttataaaatcgatcctgagaagcttgccactaacatcgcaaactttgaaaatgagctt aaagacttaagttaa

DBGET integrated database retrieval system