Shewanella sp. MR-7: Shewmr7_2436 Help Entry Shewmr7_2436      CDS       T00389                                  Name (GenBank) Glutaredoxin, GrxA family   KO K03674   glutaredoxin 1 Organism shm  Shewanella sp. MR-7 Brite KEGG Orthology (KO) [BR:shm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:shm03110]     Shewmr7_2436 Chaperones and folding catalysts [BR:shm03110]  Protein folding catalysts   Protein disulfide isomerase    Shewmr7_2436 SSDB OrthologParalogGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_3 MDH1B_N Thioredoxin_4 Thioredoxin_2 PedC-like TraF DCC1-like SH3BGR Motif Other DBs NCBI-ProteinID:  ABI43421 UniProt:  Q0HTY4 LinkDB All DBs Position 2886243..2886503 Genome browser AA seq 86 aa AA seqDB search MYVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVP QIFVDEKHVGGCTDFEQYVRDNNLLG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtacgttgttatttttggccgtcctggctgtccttattgcgtgcgagcagtacaactg tcagagcaactcgttgaaaaacgtgatgactttaaatttagatacgtggatatccacgcc gaagggatttctaaagcggatctcgagaagactgtcggcaagccagtcgaaactgtgcca cagatcttcgttgatgaaaaacacgtaggtggttgcaccgatttcgaacaatatgttcgc gataacaatctgttaggttaa

DBGET integrated database retrieval system