Shewanella alkalitolerans: K0J45_06935 Help Entry K0J45_06935       CDS       T09228                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shns  Shewanella alkalitolerans Pathway shns01100   Metabolic pathways shns01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shns00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0J45_06935    00074 Mycolic acid biosynthesis     K0J45_06935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0J45_06935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QYJ98954 LinkDB All DBs Position 1558491..1558706 Genome browser AA seq 71 aa AA seqDB search MVNFLEELAEILELDVKELTPEFEYQEAEAWDSLAQLTLMALFADEYQIEINSSDLNERK TVGQLLALLPQ NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggtaaattttttagaagaactagctgaaattttagaactagatgtaaaagagcttacg cctgaatttgaataccaagaagctgaagcgtgggactctctagctcaactaactctcatg gcattattcgctgatgaatatcaaatcgaaataaatagcagtgatctaaatgaaagaaaa actgttggccagctcttagctctactccctcaataa

DBGET integrated database retrieval system